GPR173 (217-269) (Human, Rat, Mouse, Porcine, Canine, Bovine)

BYL-721

Sequence:  ()

    MKPVQMVPAISQNWTFHGPGATGQAAANWIAGFGRGPMPPTLLGIRQNGHAAS
      Molecular Weight: 5498.72
      Validation: Exhibits correct molecular weight
      Solubility: Insoluble in water.
      Dissolve with a small amount of DMSO or 30% acetonitrile in water. Then dilute with water or any desired buffer.
      Storage: Store in dry form at 0-5°C.
      For best results, rehydrate just before use.
      After rehydration, keep solution at +4°C for up to 4 days or freeze for longer-term storage. Aliquot before freezing to avoid repeated freeze-thaw cycles.
      Appearance: White powder
      Contents: Each vial contains 100 µg of NET peptide.

rsos.150402