Sequence: ()
MKPVQMVPAISQNWTFHGPGATGQAAANWIAGFGRGPMPPTLLGIRQNGHAAS
Dissolve with a small amount of DMSO or 30% acetonitrile in water. Then dilute with water or any desired buffer.
For best results, rehydrate just before use.
After rehydration, keep solution at +4°C for up to 4 days or freeze for longer-term storage. Aliquot before freezing to avoid repeated freeze-thaw cycles.