Name :
DRD5 (Human) Recombinant Protein
Biological Activity :
Human DRD5 full-length ORF (ABM82859.1) recombinant protein without tag.This product is belong to Proteoliposome (PL).Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength,Proteoliposome,Proteoliposomes,Membrane Protein,Membrane Proteins
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
ABM82859.1
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=1816
Amino Acid Sequence :
MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVLVCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFDIMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNWHRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYAFNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTPGNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH
Molecular Weight :
52.47
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Mouse (82); Rat (82)
Preparation Method :
in vitro wheat germ expression system with proprietary liposome technology
Purification :
None
Quality Control Testing :
Storage Buffer :
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Applications :
Antibody Production，
Gene Name :
DRD5
Gene Alias :
DBDR, DRD1B, DRD1L2, MGC10601
Gene Description :
dopamine receptor D5
Gene Summary :
This gene encodes the D5 subtype of the dopamine receptor. The D5 subtype is a G-protein coupled receptor which stimulates adenylyl cyclase. This receptor is expressed in neurons in the limbic regions of the brain. It has a 10-fold higher affinity for dopamine than the D1 subtype. Pseudogenes related to this gene reside on chromosomes 1 and 2. [provided by RefSeq
Other Designations :
D1beta dopamine receptor|dopamine receptor D1B
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
AOC3 Proteincustom synthesis
IL-3 ProteinPurity & Documentation
Popular categories:
CCR10
Caspase
