Share this post on:

Name :
CSF1 (Human) Recombinant Protein

Biological Activity :
Human CSF1 (P09603, 33 a.a. – 190 a.a.) partial-length recombinant protein expressed in Escherichia coli.

Tag :

Protein Accession No. :
P09603

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=1435

Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN.

Molecular Weight :
20.7

Storage and Stability :
Store at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :

Quality Control Testing :

Storage Buffer :
20mM Tris-HCl, pH-8, 2mM DTT & 10% Glycerol.

Applications :
SDS-PAGE,

Gene Name :
CSF1

Gene Alias :
MCSF, MGC31930

Gene Description :
colony stimulating factor 1 (macrophage)

Gene Summary :
The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Four transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq

Other Designations :
OTTHUMP00000013362|OTTHUMP00000013363|OTTHUMP00000013364|colony stimulating factor 1|macrophage colony stimulating factor

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-10 Proteinsupplier
IL-4 ProteinMedChemExpress
Popular categories:
TLX/PNR
DAF Protein/CD55

Share this post on:

Author: nucleoside analogue