Product Name :
CPTC-TNK2-3
Clone ID/Product Name: CPTC-TNK2-3;
Available to For-Profits: Yes;
Alternate Antibody Name: ;
Gene Symbol: TNK2;
Ab Isotype: MIgG2b;
Gene Name: ;
Antibody Registry ID: AB_2877112 ;
Uniprot ID: Q07912 ;
Entrez Gene ID: 10188 ;
Clonality: Monoclonal;
Immunogen: Recombinant protein domain;
Immunogen Sequence: SPEEPTPLPVPLLLPPPSTPAPAAPTATVRPMPQAALDPKANFSTNNSNP GARPPPPRATARLPQRGCPGDG ;
Myeloma Strain: P3x63Ag8.653;
Epitope Mapped: No;
Antigen Name: Tyrosine Kinase Non Receptor 2;
Epitope Location or Sequence: ;
Alternate Antigen Name: ;
Deposit Date: 10/28/2020;
Antigen Molecular Weight: 114.5 kDa;
Antigen Sequence: ;
Depositor Institution: National Cancer Institute;
Antigen Species: Human;
Depositor Notes: ;
Host Species: mouse;
Hybridoma Cells Available : No;
Confirmed Species Reactivity: Human;
Additional Information: ;
Predicted Species Reactivity: ;
Human Protein Atlas: ;
Additional Characterization: https://antibodies.cancer.gov/detail/CPTC-TNK2-3#CPTC-TNK2-3 ;
Recommended Applications: ELISA, Western Blot;
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
SIRT6 Antibody
FKBP51 Antibody
CD3G Antibody: CD3G Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 20 kDa, targeting to CD3G. It can be used for WB,IHC-P,IP assays with tag free, in the background of Human.
