CPTC-TNK2-3

Share this post on:

Product Name :
CPTC-TNK2-3
Clone ID/Product Name: CPTC-TNK2-3;
Available to For-Profits: Yes;
Alternate Antibody Name: ;
Gene Symbol: TNK2;
Ab Isotype: MIgG2b;
Gene Name: ;
Antibody Registry ID: AB_2877112 ;
Uniprot ID: Q07912 ;
Entrez Gene ID: 10188 ;
Clonality: Monoclonal;
Immunogen: Recombinant protein domain;
Immunogen Sequence: SPEEPTPLPVPLLLPPPSTPAPAAPTATVRPMPQAALDPKANFSTNNSNP GARPPPPRATARLPQRGCPGDG ;
Myeloma Strain: P3x63Ag8.653;
Epitope Mapped: No;
Antigen Name: Tyrosine Kinase Non Receptor 2;
Epitope Location or Sequence: ;
Alternate Antigen Name: ;
Deposit Date: 10/28/2020;
Antigen Molecular Weight: 114.5 kDa;
Antigen Sequence: ;
Depositor Institution: National Cancer Institute;
Antigen Species: Human;
Depositor Notes: ;
Host Species: mouse;
Hybridoma Cells Available : No;
Confirmed Species Reactivity: Human;
Additional Information: ;
Predicted Species Reactivity: ;
Human Protein Atlas: ;
Additional Characterization: https://antibodies.cancer.gov/detail/CPTC-TNK2-3#CPTC-TNK2-3 ;
Recommended Applications: ELISA, Western Blot;

Antibodies are immunoglobulins secreted by effector lymphoid B cells into the bloodstream. Antibodies consist of two light peptide chains and two heavy peptide chains that are linked to each other by disulfide bonds to form a “Y” shaped structure. Both tips of the “Y” structure contain binding sites for a specific antigen. Antibodies are commonly used in medical research, pharmacological research, laboratory research, and health and epidemiological research. They play an important role in hot research areas such as targeted drug development, in vitro diagnostic assays, characterization of signaling pathways, detection of protein expression levels, and identification of candidate biomarkers.
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
SIRT6 Antibody
FKBP51 Antibody
CD3G Antibody: CD3G Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 20 kDa, targeting to CD3G. It can be used for WB,IHC-P,IP assays with tag free, in the background of Human.