Product Name :
GABRG2-R86
Clone ID/Product Name: GABRG2-R86;
Available to For-Profits: Yes;
Alternate Antibody Name: ;
Gene Symbol: Gabrg2;
Ab Isotype: Rabbit IgG;
Gene Name: ;
Antibody Registry ID: AB_2877081 ;
Uniprot ID: P18508 ;
Entrez Gene ID: 29709 ;
Clonality: Polyclonal;
Immunogen: Synthetic peptide;
Immunogen Sequence: QKSDDDYEDYASNKTWVLTPKVPEGDVTVC ;
Myeloma Strain: ;
Epitope Mapped: Yes;
Antigen Name: Gamma-aminobutyric acid receptor subunit gamma-2;
Epitope Location or Sequence: N-terminus amino acids 1-15;
Alternate Antigen Name: ;
Deposit Date: 6/2/2019;
Antigen Molecular Weight: 54.0 kDa;
Antigen Sequence: ;
Depositor Institution: University of Connecticut;
Antigen Species: Rat;
Depositor Notes: The synthetic peptide immunogen was coupled to a carrier protein by a C-end, which was added if not present in the peptide. IP, IB ;
Host Species: rabbit;
Hybridoma Cells Available : No;
Confirmed Species Reactivity: Rat;
Additional Information: Affinity-purified antibody also validated for IHC and IF.;
Predicted Species Reactivity: ;
Human Protein Atlas: ;
Additional Characterization: ;
Recommended Applications: Immunoprecipitation, Western Blot;
Related websites: https://www.medchemexpress.com/antibodies.html
Popular product recommendations:
Iba1 Rabbit mAb In stock
Mepolizumab (anti-IL5) Formula
gamma Catenin Antibody: gamma Catenin Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 82 kDa, targeting to gamma Catenin. It can be used for WB,IHC-F,IHC-P,ICC/IF assays with tag free, in the background of Human.
